PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sof009975
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae; Saccharum; Saccharum officinarum complex
Family HD-ZIP
Protein Properties Length: 258aa    MW: 28651.8 Da    PI: 6.6524
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Saccharum_officinarum-109077PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.35.3e-18113166356
                --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                k+++++ eq+++Le+ Fe  +++  e++ +LA+ lgL+ rqV +WFqNrRa++k
  Sof009975 113 KKRRLNVEQVRTLEKNFELGNKLEPERKLQLARALGLQPRQVAIWFQNRRARWK 166
                4568999**********************************************9 PP

2HD-ZIP_I/II129.41.5e-41112203192
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                  ekkrrl+ eqv++LE++Fe  +kLeperK +lar+Lglqprqva+WFqnrRAR+ktkqlEkdy+aLkr++da+k++n++L +++++L++e+ 
    Sof009975 112 EKKRRLNVEQVRTLEKNFELGNKLEPERKLQLARALGLQPRQVAIWFQNRRARWKTKQLEKDYDALKRQLDAVKADNDALLSHNKKLQAEIV 203
                  69**************************************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-1894169IPR009057Homeodomain-like
SuperFamilySSF466898.98E-20101170IPR009057Homeodomain-like
PROSITE profilePS5007117.346108168IPR001356Homeobox domain
SMARTSM003891.3E-17111172IPR001356Homeobox domain
CDDcd000861.36E-16113169No hitNo description
PfamPF000462.1E-15113166IPR001356Homeobox domain
PRINTSPR000311.1E-5139148IPR000047Helix-turn-helix motif
PROSITE patternPS000270143166IPR017970Homeobox, conserved site
PRINTSPR000311.1E-5148164IPR000047Helix-turn-helix motif
PfamPF021837.7E-15168207IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
MASNGMASSP SPFFPPNFLL QMQQTPSDHD PQEQHHHHHE HHLPGAPPLH PHHNPFLPSS  60
QCPSLQDFRG MAPMLGKRPM YGADVVVGGE EVNGGGGANE DEMSDDGSQA GEKKRRLNVE  120
QVRTLEKNFE LGNKLEPERK LQLARALGLQ PRQVAIWFQN RRARWKTKQL EKDYDALKRQ  180
LDAVKADNDA LLSHNKKLQA EIVALKGGRE AGSSELINLN KETEASCSNR SENSFEINLD  240
ISRTPASDGP MDPPPPTX
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1160168RRARWKTKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sof.153150.0inflorescence| leaf| meristem| stem
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002465782.11e-155hypothetical protein SORBIDRAFT_01g045740
SwissprotQ8S7W91e-110HOX21_ORYSJ; Homeobox-leucine zipper protein HOX21
TrEMBLC5WVY21e-155C5WVY2_SORBI; Putative uncharacterized protein Sb01g045740
STRINGSb01g045740.11e-155(Sorghum bicolor)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.13e-72HD-ZIP family protein